HORDB

ID: hor000776
Uniprot ID: P05060
Protein name: CCB peptide
Gene name: CHGB
Organism: Homo sapiens (Human)
Family: Chromogranin/secretogranin protein family
Source: Human
Expression: Expressed in the adrenal medulla, and in pheochromocytoma. Not expressed in liver.
Disease: Diseases associated with CHGB include Pheochromocytoma and Neuroendocrine Tumor.
Comments: NA
Taxonomy: Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005515 protein binding
GO BP: GO:0007165 signal transduction
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005788 endoplasmic reticulum lumen; GO:0030141 secretory granule

Sequence: SAEFPDFYDSEEPVSTHQEAENEKDRADQTVLTEDEKKELENLAAMDLELQKIAEKF
Length: 57(617-673)
Propeptide: MQPTLLLSLLGAVGLAAVNSMPVDNRNHNEGMVTRCIIEVLSNALSKSSAPPITPECRQVLKTSRKDVKDKETTENENTKFEVRLLRDPADASEAHESSSRGEAGAPGEEDIQGPTKADTEKWAEGGGHSRERADEPQWSLYPSDSQVSEEVKTRHSEKSQREDEEEEEGENYQKGERGEDSSEEKHLEEPGETQNAFLNERKQASAIKKEELVARSETHAAGHSQEKTHSREKSSQESGEETGSQENHPQESKG
Signal peptide: MQPTLLLSLLGAVGLAAVNS
Modification: T1 Phosphoserine;T8 Sulfotyrosine;T10 Phosphoserine;T15 Phosphoserine
Glycosylation: NA
Mutagenesis: NA

Function: Secretogranin-1 is a neuroendocrine secretory granule protein, which may be the precursor for other biologically active peptides.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

AF-Q9N4V0-F1.pdb

hor000776_AF2.pdb

hor000776_ESM.pdb

Mass:	760216	Formula:	C285H440N72O106S
Absent amino acids:	CGW	Common amino acids:	E
pI:	3.87	Basic residues:	7
Polar residues:	9	Hydrophobic residues:	17
Hydrophobicity:	-111.75	Boman Index:	-16957
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	61.75
Instability Index:	5122.11	Extinction Coefficient cystines:	1490
Absorbance 280nm:	26.61

PubMed ID: 3678488
Title: Chromogranin B (Secretogranin I), a Putative Precursor of Two Novel Pituitary Peptides Through Processing at Paired Basic Residues