General Information

  • ID:  hor000776
  • Uniprot ID:  P05060
  • Protein name:  CCB peptide
  • Gene name:  CHGB
  • Organism:  Homo sapiens (Human)
  • Family:  Chromogranin/secretogranin protein family
  • Source:  Human
  • Expression:  Expressed in the adrenal medulla, and in pheochromocytoma. Not expressed in liver.
  • Disease:  Diseases associated with CHGB include Pheochromocytoma and Neuroendocrine Tumor.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005515 protein binding
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005788 endoplasmic reticulum lumen; GO:0030141 secretory granule

Sequence Information

  • Sequence:  SAEFPDFYDSEEPVSTHQEAENEKDRADQTVLTEDEKKELENLAAMDLELQKIAEKF
  • Length:  57
  • Propeptide:  MQPTLLLSLLGAVGLAAVNSMPVDNRNHNEGMVTRCIIEVLSNALSKSSAPPITPECRQVLKTSRKDVKDKETTENENTKFEVRLLRDPADASEAHESSSRGEAGAPGEEDIQGPTKADTEKWAEGGGHSRERADEPQWSLYPSDSQVSEEVKTRHSEKSQREDEEEEEGENYQKGERGEDSSEEKHLEEPGETQNAFLNERKQASAIKKEELVARSETHAAGHSQEKTHSREKSSQESGEETGSQENHPQESKGQPRSQEESEEGEEDATSEVDKRRTRPRHHHGRSRPDRSSQGGSLPSEEKGHPQEESEESNVSMASLGEKRDHHSTHYRASEEEPEYGEEIKGYPGVQAPEDLEWERYRGRGSEEYRAPRPQSEESWDEEDKRNYPSLELDKMAHGYGEESEEERGLEPGKGRHHRGRGGEPRAYFMSDTREEKRFLGEGHHRVQENQMDKARRHPQGAWKELDRNYLNYGEEGAPGKWQQQGDLQDTKENREEARFQDKQYSSHHTAEKRKRLGELFNPYYDPLQWKSSHFERRDNMNDNFLEGEEENELTLNEKNFFPEYNYDWWEKKPFSEDVNWGYEKRNLARVPKLDLKRQYDRVAQLDQLLHYRKKSAEFPDFYDSEEPVSTHQEAENEKDRADQTVLTEDEKKELENLAAMDLELQKIAEKFSQRG
  • Signal peptide:  MQPTLLLSLLGAVGLAAVNS
  • Modification:  T1 Phosphoserine;T8 Sulfotyrosine;T10 Phosphoserine;T15 Phosphoserine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Secretogranin-1 is a neuroendocrine secretory granule protein, which may be the precursor for other biologically active peptides.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9N4V0-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-Q9N4V0-F1.pdbhor000776_AF2.pdbhor000776_ESM.pdb

Physical Information

Mass: 760216 Formula: C285H440N72O106S
Absent amino acids: CGW Common amino acids: E
pI: 3.87 Basic residues: 7
Polar residues: 9 Hydrophobic residues: 17
Hydrophobicity: -111.75 Boman Index: -16957
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 61.75
Instability Index: 5122.11 Extinction Coefficient cystines: 1490
Absorbance 280nm: 26.61

Literature

  • PubMed ID:  3678488
  • Title:  Chromogranin B (Secretogranin I), a Putative Precursor of Two Novel Pituitary Peptides Through Processing at Paired Basic Residues